Chicken Breast with Green Noodle Salad
30 min
Veggie noodles made from zucchini and carrot, tossed with capers, lemon, and basil — quick weeknight dinner that actually feels fresh.
chickenhealthyquick
All Recipes
4 recipes
Allamericanasianautumnbakedbakingbeefbreadbreakfastcakechickenchristmascomfort foodcookiescreamycrispydairy-freedessertdinnerdoughdrinkdumplingseastereasyeggfamily dinnerfermentedfinger foodfishfreezer-friendlyfrenchfriedgluten-freegreekgrilledgrillinghealthyheartyhigh-proteinindianitalianjapanesefor kidslamblightlunchlunchboxmeatmexicanmuffinsno-cooknorwegianone-potpartypastapicnicpizzapolishporkquicksaladsalmonsandwichseafoodside dishsnacksoupspicystewsugar-freesummertacotraditionalturkishveganvegetarianweeknightwinter
Blueberry Smoothie with Egg
5 min
Perfect for hectic mornings — ready in minutes and filling enough to actually keep you going. The egg gives it a protein boost you won't even taste.
breakfastdrinkegg
Oat and Cottage Cheese Waffles
15 min
Protein-packed waffles we make on slow weekend mornings — oats keep you full, cottage cheese keeps them soft in the middle.
breakfasthigh-proteinbaked
Oven-Baked Chicken Stuffed with Cheese and Wrapped in Cured Ham
45 min
Tender chicken breast wrapped in cured ham and filled with flavorful cheese. Served with sweet potato mash and tomatoes. Choose quality chicken and good cheese for best results.
chickenbakeddinner